PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2834s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 25951.8 Da    PI: 10.1852
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2834s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.15.4e-291058250
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         rienk++rqvtfskRr+g+ KKA+E+SvLCda+va+i+fs++gkl+eys
  Cagra.2834s0001.1.p 10 RIENKIRRQVTFSKRRAGLVKKAQEISVLCDADVALIVFSPKGKLFEYS 58
                         8***********************************************8 PP

2K-box74.82.5e-25881701495
                K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe.enkaLr 95 
                          + ++++e ++L + i+ +qr++Rhl+Ge+++ Ls++eLq Le qL+++lkk Rs+Kn+l++e+i +lqkk  + ++ e ++Lr
  Cagra.2834s0001.1.p  88 QGECSTECSRLLRMIDVMQRSIRHLKGEEVDALSIRELQGLEMQLDTALKKTRSRKNQLMIESIAQLQKKAGQREDfEPQNLR 170
                          467899****************************************************************8665542445555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.572161IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.21E-39278No hitNo description
SuperFamilySSF554553.66E-31284IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2187171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.22788179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRGRVQLRR IENKIRRQVT FSKRRAGLVK KAQEISVLCD ADVALIVFSP KGKLFEYSAG  60
SSMERILDRY ERSSYAGQET PTPNLDSQGE CSTECSRLLR MIDVMQRSIR HLKGEEVDAL  120
SIRELQGLEM QLDTALKKTR SRKNQLMIES IAQLQKKAGQ REDFEPQNLR HDLATPPCAS  180
PQALPRPISP PPPISFGETS QRNGVEGVAA GTLIRNTNTT LPHWMPRLTG E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-19174173Myocyte-specific enhancer factor 2B
1tqe_R2e-19174173Myocyte-specific enhancer factor 2B
1tqe_S2e-19174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412381e-167AY141238.1 Arabidopsis thaliana MADS-box protein AGL79 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292203.11e-153hypothetical protein CARUB_v10018408mg
SwissprotB4YPW65e-66AP1A_BRAOA; Floral homeotic protein APETALA 1 A
SwissprotQ8GTF55e-66AP1A_BRAOB; Floral homeotic protein APETALA 1 A
SwissprotQ963565e-662AP1_BRAOT; Floral homeotic protein APETALA 1-2
TrEMBLR0FS021e-153R0FS02_9BRAS; Uncharacterized protein
STRINGAT3G30260.11e-131(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130331525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.11e-132AGAMOUS-like 79